DPCstruct | MC163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 430 ± 84 aa |
| Standard deviation of domain lengths | 83.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9JMX6 | 1-369 | MTVPKTLAFCYLSLLWQRETITLSDLLRFVEEDHIPYINTFQHFPEQMKLYGRDKGIFTIESWPDYEDIYKKAIEVATFLDLPRFPD… |
| A0A7I9FAZ9 | 340-725 | LFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLRILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICSAK… |
| A0A3Q7WNF8 | 42-461 | None |
| A0A507E641 | 21-429 | None |
| A0A383VGK7 | 20-547 | None |
| A0A1L0B067 | 62-584 | None |
| A0A1X2HI67 | 19-349 | None |
| A0A6A3LVS6 | 185-698 | None |
| A0A199UFZ1 | 69-725 | None |
| A0A3Q2TCZ1 | 38-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.