DPCstruct | MC16294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 160 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0B8P0 | 81-218 | KAYLTESNLGRFLRDLKDRTIDVTINGKSIDNVSFVKDDFSLDFNVETKNNKILLKQTSDIAMPISPGGKYFLYQGKIYEPSEELIK… |
| A0A3E2EBT6 | 12-165 | TVYKRELNIAGDQADEFLEAAQAAPFFGAVDEESSREWEIREGEPERLLEINGDKTGISIKLQRMQFVTGNRYGYFFDDGIIWKTDR… |
| A0A068N6H9 | 235-393 | None |
| A0A173ZB22 | 53-244 | None |
| A0A6P1ML06 | 121-299 | None |
| V9GES6 | 272-424 | None |
| A0A381IDD9 | 1-133 | None |
| T0D826 | 22-185 | None |
| A0A4V1DIH0 | 221-376 | None |
| A0A1M5VZM7 | 215-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.