DPCstruct | MC16293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14283 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373NZ75 | 1-136 | MPFTIAGNGEVEDNIVDDPSKEFFTVKTKGGNTFFLVIDRARNSENVYMLSMIDEYDLQEFLDDEERNGQQEEETPAVILPETKPEP… |
| A0A3E2EAR3 | 21-170 | VPVTPQGNAALVDDFFGDKQLITVTTKAGNYFYILIDRANEDKETAVHFLNQVDDADLQALLEDGKKEPEVCNCTAKCQAGAVNTAC… |
| K1T1I4 | 12-157 | None |
| U2KCK2 | 86-257 | None |
| A0A1G5HH15 | 44-204 | None |
| A0A1Y4F160 | 87-246 | None |
| A0A3D5IBS6 | 77-242 | None |
| A0A270AQZ3 | 54-189 | None |
| A0A645F2U5 | 1-159 | None |
| A0A2X1Y1E3 | 106-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.