DPCstruct | MC16292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 258 ± 51 aa |
| Standard deviation of domain lengths | 50.50 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1SIK3 | 156-377 | FDDSLETSDSYPSKSYGPGGGGYDDDRLEDSIAPLDDRILLTRKFIQLTCHQNRGIQRKEQLNNTYLTYCYRYKLENLFSYEIQDLI… |
| A0A6A5FTV4 | 23-281 | FFKQHNETVTDRCSVWSDDIIPEICSAGTQSRIRILKHVFLFPELQPLSLFEMFSVGLRSTDTWQLNTGEKGSDCISGSINRCTSCF… |
| A0A077ZBW3 | 3-313 | None |
| A0A819V0P1 | 61-286 | None |
| A0A2G9UWQ9 | 376-623 | None |
| A0A7J8GL31 | 140-365 | None |
| A0A3Q0J581 | 1-274 | None |
| A0A0K0DYI3 | 180-480 | None |
| A0A1A8KB04 | 9-230 | None |
| A0A3P7DT69 | 7-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.