DPCstruct | MC16291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 66.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820TN96 | 3-56 | SDLQQLGLIEKNSHLNYLRDFRVEQCQLFLQHKCTQHRPFSCFYWHFQNQRRRR |
| A0A444UBD9 | 5-60 | SKTAASASAQTEKPTHYTYLKEFRTEQCPLFLQHKCTQHRPYTCFHWHFLNQRRRR |
| A0A6A7G6X3 | 1-59 | None |
| A0A183TIG3 | 1-54 | None |
| H2YS30 | 8-59 | None |
| A0A6P3S018 | 1-64 | None |
| A0A553Q8L2 | 2-60 | None |
| A0A819CQM8 | 1-57 | None |
| A0A6A5HKF3 | 1-63 | None |
| A0A455BXR5 | 12-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.