DPCstruct | MC16288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5T4X0 | 304-374 | QKLEICSSGWLNREDLLNIKSKSVFLKKTILRNEDLNALLKQWLEERDLKLETAKIQISDGNLNEILNGIV |
| A0A2P4WC16 | 1-91 | MTILSLPRLYILNARWLTFDDLLNMECEIAVLRYHSFASEDVKQFINHWMAGSNPKLMHLRLHGFELEPNWDHILEGIEYGKPLYLQ… |
| A0A1I7UQN1 | 7-86 | None |
| A0A1I7UDN2 | 59-144 | None |
| E3N5H0 | 401-472 | None |
| A0A6A5GV22 | 136-202 | None |
| E3N5H5 | 178-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.