DPCstruct | MC16285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 168 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4WDL9 | 2-167 | DTELEKISKICMNTTDFEALTGNIVRDLVAAAMKYPLMTETGPVIGLTELRAALNFGPLPPWRHRNLTRPSEQELSSASSLEQYYDL… |
| A0A2P4VUM5 | 3-163 | SSSPLDLDKEIRAIAYANLTTEDHTRFSDRKDLRPAQELIGLTELRSALGLEPPGSNYSRTTNDGNDTSIEDYYELKEPKVGIRVDK… |
| G0N6L7 | 264-425 | None |
| E3MY35 | 31-202 | None |
| E3MY26 | 1-164 | None |
| E3MY22 | 35-224 | None |
| A0A6V7XC35 | 28-243 | None |
| A0A2G5TRE0 | 12-175 | None |
| A0A6V7WVM0 | 42-228 | None |
| G0N6L8 | 77-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.