DPCstruct | MC16284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3AP68 | 142-237 | RRWWLSGAEDSAAVGDRISILLEQAKHCPDDAIVIVGHSLIFRQLFRTCLHPAFRERSPALAATLTDAKLQHCQVACCVLDFDLGPQ… |
| A0A7S2FTU8 | 3-101 | KWWSSSPEGKQDVKERIDEFMMRLRYADDDAPIIVVGHSHYWRTVLNKCMAVEAQKGSELAIKVGQLKLGNGGVIYCRLNFDLGRRL… |
| A0A7R9UR69 | 13-130 | None |
| A0A482SL39 | 51-170 | None |
| A0A7S4M8T6 | 1-106 | None |
| A0A7S4N860 | 1-103 | None |
| R1C6T1 | 41-169 | None |
| A0A7S4F2N0 | 185-300 | None |
| A0A7S2C1P8 | 85-197 | None |
| A0A7S2TLZ1 | 149-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.