DPCstruct | MC16283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Standard deviation of domain lengths | 23.15 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9PCQ8 | 2-84 | STIVKLCLKSLQEFIRLQTFNRSGYQQIQLDIEYLKTPLKEIAADATVIDFLLKEVNNAAHERSLDPIPLEPTIVDRLIEAKQ |
| A0A7S2FP21 | 7-98 | VSYEAESVMLCVLKAMLKAMIEAVRQCTFTTSAYQQVQADCQLLRQMMPYFLQDPSVPESMLDEVLVSAGERCAQPEGMESSDVLAL… |
| L8HJP2 | 221-319 | None |
| A0A7S1SX82 | 47-155 | None |
| A0A1Y3BHS1 | 2-75 | None |
| A0A7S0TZ94 | 7-103 | None |
| A0A368F405 | 39-133 | None |
| A0A418AP33 | 16-116 | None |
| A0A6L5DGT0 | 573-653 | None |
| W2SMG9 | 612-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.