DPCstruct | MC16281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 205 ± 25 aa |
| Standard deviation of domain lengths | 24.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396GF20 | 35-200 | ALISLSSRQLMFVMDSIIWAFWHTEKNIAETVLKLSLEMLNKFQASKFCNQFYRTYILTIEQEIFAVLIDTLHKSGFKLHVLVLQHL… |
| A0A7S2CSW2 | 42-258 | ALFSIPQEHQKLVVDSVAYAIKHTERNVADMGLDIMFELLQNVARTPQFAQVFYQNFLLSLVQDVLYVMTDRLHKSGFKMHATLLRT… |
| A0A7S7LHW1 | 973-1246 | None |
| A0A7J9IYT5 | 5-200 | None |
| A0A183M4M3 | 2-173 | None |
| A0A7S2SWA8 | 112-337 | None |
| A0A7S1GGX2 | 10-214 | None |
| Q7RP59 | 360-566 | None |
| A0A0S7KU37 | 146-354 | None |
| A0A1I7X0S0 | 467-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.