DPCstruct | MC1628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4G736 | 11-110 | FAARDFEVQEPVVYLKPGSTGAVTSGGIYTGSSSRTYVVEIVEGGGVGSGTYKVSADGGQTWSAVQTIPAGAVNLGDGVQATLSGTW… |
| A0A1F9MM07 | 29-133 | GELLQTTPVSVSEPAKSGSGSATMKVLGAYRSEYPQDYLIDILSSGEVGAATFRWSLNQGQSWEETDLTTAGADGPVELDQGLSVFW… |
| F2NCR6 | 325-426 | None |
| A0A849GW47 | 10-119 | None |
| V6HZ19 | 87-193 | None |
| A0A0F9SXG6 | 67-185 | None |
| A0A7X1ZTI1 | 80-185 | None |
| A0A7Y4VH31 | 302-399 | None |
| A0A1E3X2L5 | 204-321 | None |
| A0A0F9RUD2 | 15-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.