DPCstruct | MC16279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 29 aa |
| Standard deviation of domain lengths | 28.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1S7Z2 | 47-197 | LEVFRKGQDTELRAREVPKGEECRVKLTEEVLKELDKEDPWTELFSRVGVDPGPPRRIVVASQIGQGEASLPPAGTSMLITTFRYSA… |
| A0A7S2U2U0 | 126-273 | RLKCMRDVDPAKVVKTKTNRRKKTHKLNPLDHGGFKAYASRKNDKPMGRKENRSKAAENVIYKEGRIIDDKYVIVTVIENIVDRVFS… |
| A0A812NB59 | 28-161 | None |
| D7FYU0 | 30-189 | None |
| A0A7S3S8U4 | 1-105 | None |
| A0A7S2DQL5 | 364-558 | None |
| A0A7S3YLR2 | 67-255 | None |
| A0A7J6SWX2 | 3-107 | None |
| T0Q764 | 1-128 | None |
| A0A813GB52 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.