DPCstruct | MC16277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 302 ± 60 aa |
| Standard deviation of domain lengths | 60.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7HMA2 | 56-334 | SPLKFRGYMTVYPKVQCICYTIDVAEPTFCEIILSLANNSDVPRDRFLNDLFLIVYNMHDELIGITRHVLSDGHYSTGMMTVNSGDK… |
| A0A7S2C3E6 | 27-364 | FSINVCMVAQHGSQHPQWVEKRRKVSFTYGGEDQISAPMYIISVTQKCEMYISVHQEDERCEGAKPYLDIGVTVLQIQPDYSYKLVA… |
| A0A6P4ZEL6 | 34-356 | None |
| R7TB67 | 250-585 | None |
| A0A5F7ZI92 | 194-524 | None |
| A0A0B2VE37 | 200-487 | None |
| A0A6A4VFI3 | 78-326 | None |
| K1Q017 | 442-788 | None |
| K7HA92 | 47-277 | None |
| A9V7E5 | 114-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.