DPCstruct | MC16275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 98.74 |
| Assigned Pfam label(s) | CL0125- PF06337- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2KP98 | 69-189 | HLRAYNDRKQAEYDLVSKYDTKDTGDGRGWYLVDALWVNKWKRYVRADHVTDIRDICHPGPVTNSRLIDPKTGAPKSTLKVRTDYIG… |
| A0A7S2C1S0 | 4-131 | ERKGPKGEFAQVLALDKQVLDGKEGEEGTKAGEGKYCVIEAGWVSSWLAFVYYNDSSPAPGKIQNSKLLDHSGCPIEGIQLASDKKS… |
| A0A2B4SAV7 | 49-179 | None |
| A0A0P1AXX0 | 404-571 | None |
| F4PN35 | 210-333 | None |
| F4PT10 | 5-96 | None |
| F4Q171 | 18-122 | None |
| A0A6J5VEL8 | 1-155 | None |
| A0A7S4P2Q8 | 58-193 | None |
| K3WEL7 | 317-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.