DPCstruct | MC16273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 182 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6U6W9 | 102-275 | VKFFLEPLDDGSLPAYNIQRDLMTSLGKLPINKEALIASGIGKVIVFYTRSKRPEPGIKRMAERLLAEWTRPILQRSDDYSKRVYQE… |
| A0A7C8QZE1 | 158-336 | LRFWLEPLPDRSLPAYDIQRELFQILVEMPDIKYDELRISGLGKLLNFYIRDARPQQHIRFTAQKLYENWSRPILEKSNNYRHRKIE… |
| A0A177WET7 | 2-140 | None |
| A0A180FY68 | 1-172 | None |
| A0A2U1QHH6 | 829-1018 | None |
| A0A7R8XA88 | 189-386 | None |
| A0A1I7V7B0 | 449-632 | None |
| A0A5N6NTN4 | 312-518 | None |
| A0A0C9LZQ1 | 214-391 | None |
| A0A6P8SBE5 | 983-1186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.