DPCstruct | MC16272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 218 ± 49 aa |
| Standard deviation of domain lengths | 48.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0Y7W9 | 435-655 | PDAFLLLSKFLWRQGYVRCPATCSWDTEPADCECSCPSTLTGVGVTRSASEFLEFAGVDALNPNSNLELLMDEYGLNDTQYLDALCH… |
| A0A6T7BRG6 | 2-200 | DLWRSGLLECPTACGSDTPATECKCHCPDLEKWIHDEAGPRIMGVADMVDGDKTVNAEGEDLSKVFMRLLCNDYDDMAPQMGDLMNS… |
| A0A7S2F469 | 100-313 | None |
| F0Y929 | 348-594 | None |
| F0YBG0 | 317-602 | None |
| F0YFT9 | 376-642 | None |
| F0YJP7 | 421-661 | None |
| A0A7S2E539 | 2-123 | None |
| F0Y8A8 | 227-486 | None |
| A0A7S2FWC8 | 104-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.