DPCstruct | MC16271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 322 ± 48 aa |
| Standard deviation of domain lengths | 48.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 74.29 |
| Assigned Pfam label(s) | PF05140- CL0328- PF16327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7I878 | 7-182 | PLGLITSAASIAALAGIVGVFIFLPEVRKVTSTMGIYGLHFGVALVFLGVAWSGPNQIVGEFVLAKGETAQIGDYTLTYKQLTESQT… |
| A0A2H6K5L5 | 71-344 | GKRVSHLLVSMKLALTLLLVLAILSIIGTILPQGEKVINSGWIDNPLYNFYRHLGLFDMYHSRWFLALLFLLAFNLIVCIYNRLPTA… |
| A0A3S0JI32 | 272-619 | None |
| A0A7H4MLT6 | 2-248 | None |
| A0A4P1R1D3 | 791-1156 | None |
| A0A265Q619 | 5-278 | None |
| A0A5P1FCL5 | 112-461 | None |
| A0A850L3C1 | 22-403 | None |
| A0A1W4V097 | 96-438 | None |
| A0A852ZTP9 | 65-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.