DPCstruct | MC1627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5EWC8 | 61-203 | SAVSVTVAPDIFDQQGERYEEGLGDGWETSPGFLVETDDQDKAAAALYAAAGRFMSVDQNGKELTPAEMTGDYPQYTPNYVSDVYLT… |
| A0A7Y6A460 | 82-224 | SAAWGAAVTAQFGTGSITVDPALFAPVTNEWGMTQALDNGVTVVGDDPAAVRVAMAAAATRFFAVDAEGVEHADAESLDLAEGRILD… |
| A0A6G7XKA2 | 1-145 | None |
| A0A0K8QBZ6 | 1-132 | None |
| A0A4U2YRG4 | 55-178 | None |
| A0A6G7YBC2 | 61-194 | None |
| A0A1M5G5K8 | 43-172 | None |
| A0A3A9YZA6 | 76-218 | None |
| A0A6B3BLS3 | 24-152 | None |
| A0A2A9CV06 | 56-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.