DPCstruct | MC16269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.40 |
| Pfam Score | 92.31 |
| Assigned Pfam label(s) | PF01265- PF06792- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847IP47 | 1-55 | VICHGGPIAEPEDAQYIFDHTKGIVGFFGASSMERIPVEVAIKANAERFKSLKMH |
| A0A838SS01 | 1-78 | TLDDCVDRVDRWGAAARAARSDVLVLCHGGPIAMPEDASYVLGRAEDVHGFYGASSMERLPTEQALKAQTEAFKAVTF |
| A0A7J0EUQ5 | 612-701 | None |
| A0A0F8WTX0 | 667-756 | None |
| W4ER08 | 14-90 | None |
| A0A6G1DWB2 | 469-558 | None |
| A0A820N6J3 | 1-67 | None |
| A0A3L7SPP3 | 7-83 | None |
| A0A453RH78 | 282-371 | None |
| A0A192M7W0 | 61-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.