DPCstruct | MC16266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345FXC5 | 2-82 | PPQLVATFTNSLGRKHLWRFKEIDTRLPPQEIKEACELLTTLDIFEQNGVKLFDSVVTAKIVTTIEHEIFDRTSVSTEEPT |
| A0A6N9I0F9 | 2-84 | KELSLKFKNGDGKASHLKLRYVSEDLTESAVRAAMKTIAESNVVVDKDNHLTYVTPVSAQYIDTVNTVIFDDEPVKKPHASTP |
| R2QIA5 | 1-86 | None |
| S0LF85 | 74-160 | None |
| A0A2G6M5R3 | 1-67 | None |
| A0A345FUP9 | 6-99 | None |
| A0A371J315 | 1-72 | None |
| A0A1L8WWU2 | 136-224 | None |
| A0A2N2BVZ5 | 29-97 | None |
| R2Q8Z1 | 129-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.