DPCstruct | MC16265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5SZD4 | 2-106 | GRIVLAYHGCDITTRDGFVRGQITPEISENRYDWLGKGLYFFEGDWKRALNLANFAHSHPDLFLTQKPIATPAVVGTVLDVDRWLDL… |
| A0A4V0XF31 | 10-92 | HRVIVAFHGCDQATADRVLVTGEPMKPSSNQWDWLAEGIYFWNQDPERAWAFAEEQHARGKVEKLSVIGAFIHLGRCFDLTRS |
| A0A017TBV4 | 1-102 | None |
| A0A226BWI0 | 2-106 | None |
| A0A7X0A889 | 1-99 | None |
| A0A1C5Z118 | 1-88 | None |
| D9S9Z2 | 8-104 | None |
| A0A5B2W086 | 6-107 | None |
| A0A1U7HDS7 | 4-94 | None |
| W0JC04 | 4-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.