DPCstruct | MC16263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 240 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258HAM7 | 92-328 | AMFETFASTQPWIRDVELRPKSVVRDLYEKAMTFTEYVSHYKLTRSEGLLLRYLSDADRAIRQTVPDEAKTDELRDIIEWLRELVRQ… |
| A0A4Q3L183 | 3-249 | ETFNSYAQAHPWVSHENIHPKGIAREIWERCASFGEYVRDYGLQRSEGVLLRYLSQTYKAMQQSVPDGFRDDIYQEMLVFFRTMLGH… |
| A0A3D2C507 | 444-685 | None |
| A0A7X9Q2V8 | 20-252 | None |
| A0A1P8Y9W4 | 1-205 | None |
| A0A0R2XL96 | 1-206 | None |
| A0A812N408 | 53-338 | None |
| A0A7X9BGR8 | 261-505 | None |
| A0A7K2VV81 | 69-309 | None |
| A0A3S3Q813 | 259-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.