DPCstruct | MC16261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 254 ± 70 aa |
| Standard deviation of domain lengths | 70.28 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF19290- PF19289 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3KZ91 | 33-297 | AEADGQLQTEFWYDAQTHLEDLDPVEHVGHTAGHRAARMLGARPVATQVVPVIFEPQMAAGLLSGMLGALNGDMVTKKASFLRDKLG… |
| A0A6M1CKZ0 | 7-195 | RTLSRLAPRKLATQKAPVIFAPEVATGLFGHLVGAISGTSVYRKSTFLLDSLGKQILPDWLTIRELPHVIGGLASTPFDSEGVRTED… |
| F7WYZ8 | 131-317 | None |
| A0A7W8CVV0 | 279-578 | None |
| A0A537ZMA0 | 319-625 | None |
| K1YXE4 | 160-476 | None |
| A0A1G6N1S5 | 134-330 | None |
| A0A235III1 | 382-686 | None |
| A0A662H787 | 2-180 | None |
| A0A2X2TBB3 | 105-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.