DPCstruct | MC16260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0RM11 | 156-243 | SASSPAEVTIKSDDVTDKYEILISKCSKTKIKTLDKTAKGGCLWFLVDKKSKKIFNNICDELGLKPTYTKKGSKTTNYQPSYYLKKSA |
| A0A4P5W3J8 | 1-98 | MAEIRPATVEAQRPGAVTNGSTPAQGTAVPALLEELRANGATTMFDQRAKGGCLWVVDGPGAREAVARVARERGVRFYFKAPGPRCA… |
| A0A1P8F5A8 | 356-449 | None |
| A0A2T5S6D3 | 28-152 | None |
| A0A367G0T8 | 49-125 | None |
| A0A2D5UUF7 | 865-956 | None |
| C7N247 | 76-171 | None |
| A0A4S2F2L3 | 878-962 | None |
| X8HRU8 | 34-118 | None |
| A0A1H0M275 | 10-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.