DPCstruct | MC1626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 47 ± 3 aa |
| Standard deviation of domain lengths | 2.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00468 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6IX80 | 18-61 | MPKRTYQPNNLRAKKKHGFLQRMMTKSGRNVLSRRRNKGRQKLT |
| A0A177UUQ0 | 121-163 | YGSEYQPSQRKRKRKHGFLARLKSKTGRKILTRRRAKGKRFLS |
| A0A7V5GZ44 | 1-46 | None |
| A4S182 | 73-116 | None |
| A0A6P5GI10 | 106-151 | None |
| A0A661UTT2 | 24-71 | None |
| A0A2E0MS02 | 1-45 | None |
| A0A0L6V4A5 | 109-153 | None |
| A0A2M7V5E0 | 1-49 | None |
| A0A6N9YKG9 | 8-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.