DPCstruct | MC16256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09954 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2I0W7 | 4-78 | DDPLALRYAMHVVHRGDGRWHVEEAGQHSIGAFATKDEAQTAAHMRATRMHEDGRDVQVVLHGEDGSIEAEHRYE |
| A0A2M8KNP9 | 2-62 | KNHHVVLRNNNWVVKRAGAKRAISVHNTQKEAIEQATSIARNQGTAVFIHGQDGRIRDRRE |
| K9B2M2 | 3-69 | None |
| A0A7X1TZB6 | 116-191 | None |
| A0A3E1NGC2 | 1-67 | None |
| A0A1Q3YX87 | 1-84 | None |
| A0A433XFS7 | 2-77 | None |
| A0A2T2SA01 | 150-215 | None |
| A0A7W1K5H4 | 186-260 | None |
| A0A5C8PWQ7 | 12-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.