DPCstruct | MC16255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 239 ± 49 aa |
| Standard deviation of domain lengths | 49.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.57 |
| Pfam Score | 38.69 |
| Assigned Pfam label(s) | CL0023- PF13299- PF21386- CL0398- PF11718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8HP74 | 1-174 | MVHGEQNEMLRLAGALQREYEDDETCRLELFTPKNCVPVNLRFRGEKIVKVLGSLARNLPKEGQSISGVLVKKNFAYHILTPGELPT… |
| A0A0V0IP73 | 56-291 | LRLGPVVHLLQRWCADPNSLLIIEERADIKLALLPFEPMSMKVLQCSFISGIKLKKAIPLLKILQPKHVLVPESLRPHISCWNPKFS… |
| A0A803Q4B8 | 749-969 | None |
| C4JWC1 | 553-815 | None |
| A0A2G2X7P7 | 225-490 | None |
| A0A0M3IHG1 | 78-318 | None |
| A0A5J4Z843 | 571-776 | None |
| A0A7J7IFW4 | 25-204 | None |
| A0A2I1FAZ7 | 38-253 | None |
| T1P7M0 | 2-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.