DPCstruct | MC16250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3HPU8 | 212-366 | RNAKGVILRPVITAHGHFRVLNILFPTVKTHVISHECFLRGAIITAWAELFRQQQGEIWFIEEEIADYTDNTPWRFQGKTYHGWWKN… |
| K7ZZK3 | 11-175 | YGDVALRRNDPGAVLRPVIAIHGHFQWLRRRFPEVTCHSLAHECVLRGAAITAWAPEVSAGKTSLWFVVEEALAETMAQHVYRHCGS… |
| A0A811CUH8 | 139-289 | None |
| U9XRY4 | 71-250 | None |
| A0A855IIB3 | 254-451 | None |
| A0A029H0G4 | 1-123 | None |
| A0A6G3I0U9 | 18-194 | None |
| A0A827X3F5 | 266-405 | None |
| A0A777TUI9 | 20-192 | None |
| A0A379S7Y7 | 7-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.