DPCstruct | MC16249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 69.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447LEL8 | 75-156 | RGIINVFKGLSWDYKSNSPCKFGKKIIVDGLVQYDRWGFHFRHGRRREQLADLDRMLNLLDGKPVPENRNDLSVRLDAHICK |
| K7ZYH9 | 3-84 | RSVINEFESLSWNYRSNCLCYFGKKIIVESVVRYDRWGFHFSRGSRSNQLVDLERMLHLLDGKSVPDNRADIASRLDSRVSQ |
| A0A377LA23 | 59-137 | None |
| A0A5U0W6C3 | 299-382 | None |
| A0A3R0W8C4 | 18-101 | None |
| A0A608K4I9 | 75-158 | None |
| E0LU30 | 52-135 | None |
| A0A167B3D7 | 86-167 | None |
| A0A077NED4 | 6-87 | None |
| A0A6D0EMX3 | 114-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.