DPCstruct | MC16248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 256 ± 31 aa |
| Standard deviation of domain lengths | 31.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3HQ32 | 8-303 | IDLLDFNIGNFKAINDYEAIISDSYYQKYYKYKLTDDSTELIKYVIEHPLSEFLSNPIKEVSFEIGSQGCFHSNSKVIEYKLENDST… |
| A0A4Q1JZ51 | 1-246 | MDYIVIHYQYWGWDRVNEVHTIRPRGDGEYGDQWVQEGETRPAIPRPVGAPAVRRLISAVQARPVTRESAVQTLAKKTTAERIMARW… |
| A0A7K0BLZ4 | 194-486 | None |
| A0A556MXK3 | 27-265 | None |
| A0A2V8P8K2 | 21-230 | None |
| A0A556MFW5 | 13-240 | None |
| A0A848GN04 | 247-542 | None |
| A0A2S1QWP6 | 369-652 | None |
| A0A090X1D1 | 56-340 | None |
| A0A2K1Q318 | 19-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.