DPCstruct | MC16246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 22.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497YS76 | 81-226 | DFDIFDRPEYDDFDKFDFIIENLVSVFNMPKAENLIRIFKKKGYSTELNEPHNLNNSINNHKAIWLGSEVPFEKAKDVILTAKEFYP… |
| A0A1H6F7Z5 | 149-291 | KYTPSQEVTVQAYWHKKGFTSQEAEEFRIKLERDGIPTAVMKHVNPEAPDSIFIGALVNAEDAQLILSSLPYEAKYIFPLTYPRAKG… |
| A0A1W2GF62 | 121-226 | None |
| A0A3N5LG51 | 26-200 | None |
| A0A3B8IM82 | 5-134 | None |
| A0A7T0C0Z0 | 31-195 | None |
| A0A4Z0QKG8 | 114-284 | None |
| A0A357IZ62 | 42-173 | None |
| A0A2E9QFV4 | 9-128 | None |
| V5DWD6 | 296-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.