DPCstruct | MC16242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 108 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8PB09 | 1-102 | MHRSGTSLLGNILHTLGIPFGKNLIGANEHNKKGYWEDQEIVAIQDGLLIQLGLDWWKENSVDPYPKDFFLSPPLLNAQQKLKEVLS… |
| A0A2S8K9A2 | 21-124 | GNNNLKVIVTGPPRSGTSFLTGLISQMGFSPGPKDWLKKGDEHNKYGYFECMPLWNISFGVLKNLGGSFHKLPDCNPGWTAYFNAEK… |
| A0A3L7NB00 | 96-206 | None |
| A0A345ZGL3 | 1-109 | None |
| A0A8B5XAL8 | 8-116 | None |
| A0A7X1GNK8 | 4-110 | None |
| A0A317MXU6 | 6-113 | None |
| A0A126QLV5 | 1-105 | None |
| A0A0A2T9C6 | 1-109 | None |
| S5AHC5 | 4-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.