DPCstruct | MC16241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2IT10 | 34-143 | RAGIFVPSPEFNFAANATIRMGSGIVGFGNPDGTLTIYFEGNRFDDSSLHKWENKVRKSYDRMVMRAPTVSKGKLDAKQLELVGLIE… |
| A0A1G0NM99 | 2-107 | DKFLIVVPEGHTGIDAGSAVVTPAPLKGERVLCHYESNRFGAVNMKRFVEKCFHAAGRAAVAYPTIAKSMLPADSLKVVGSFDLTQR… |
| A0A5N7MRX3 | 2-109 | None |
| A0A290X1B8 | 9-123 | None |
| A0A2N2AMF8 | 7-119 | None |
| A0A0S9PZ60 | 55-164 | None |
| A0A2D8MD39 | 4-117 | None |
| I2JIS0 | 18-150 | None |
| A0A3D5EJE9 | 1-121 | None |
| A0A6N7YWC8 | 8-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.