DPCstruct | MC16240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067PVV9 | 285-389 | LRIARWDQGAESTTVREDDEVTLICNHSPISPIYGPYHPSDYVNQFLLYNIPGAKKSFIHDDEWCEVLTKDAPLPQDYEILIRILDS… |
| A0A0C2WKZ3 | 1-129 | MTSGSDTSKNTRIPPATESSENTGGRAPLPVQEPNPTAISSDNNDPAPAKAPFHPSDIINASLLDEFPDAGVALTHDDDWMSVLNKG… |
| A0A4S8KQX4 | 1-91 | None |
| A0A4Q2DJG3 | 212-315 | None |
| A0A6A4I144 | 10-138 | None |
| A0A067SLQ9 | 163-292 | None |
| V2XIX3 | 223-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.