DPCstruct | MC1624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8Z4L1 | 96-186 | REVAMDIAEGADMVMVKPGLPYLDVLYRVKQTFRVPTFAYQVSGEYAMIKAAAQNGWIDHDAVMMESLLAFKRAGADGILTYFALDA… |
| A0A2X1MA16 | 11-101 | RESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFAMDL… |
| A0A7R9BC38 | 113-201 | None |
| A0A160UGR6 | 240-330 | None |
| A0A1W9LGG7 | 101-200 | None |
| A0A832H4R1 | 12-90 | None |
| D3B3I8 | 756-853 | None |
| A0A0F4Z0M0 | 655-755 | None |
| A0A3L7YF77 | 16-95 | None |
| A0A515GF30 | 70-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.