DPCstruct | MC16238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 263 ± 45 aa |
| Standard deviation of domain lengths | 44.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E3XB60 | 15-303 | NTMKGLQRGVTGALFAFGFHKATEEELAEQRARVAEQVHEARTALEARTAAEAEAKTEKHRQVNREHVRKHRDRKRQGEMKNGTRNA… |
| A0A0C2W714 | 1-221 | MNNTGIKRRKLTDFFSIESREEKEDRMARSWDNLRVEHDKQARQAALEESKRVEQVREGNRLRKQKQRAKEKEQKMANSEANPKNQK… |
| A0A409YYG0 | 256-599 | None |
| A0A0C9WGZ3 | 2-231 | None |
| A0A5M3MFW4 | 422-635 | None |
| J0WMF3 | 145-381 | None |
| A0A4Y9ZFH0 | 180-459 | None |
| A0A6A4GEY8 | 326-550 | None |
| A0A4S4LXH5 | 396-695 | None |
| A0A409YJ76 | 456-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.