DPCstruct | MC16230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 425 ± 73 aa |
| Standard deviation of domain lengths | 72.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0287- CL0159- PF00395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416P490 | 9-306 | AIHLGLITANDNRSFDTAATRAEAFVLMARAFAYDRAETAADELSSFTDTSSMTTEQKQAAAALIGQGVVNGTSAAKLSPSNKLTRA… |
| A0A359B4N9 | 51-542 | FASAAGFSDVPDNYWAKAQIDKWVDQGLTGGYQDGTYKPGQQISRAEFVALVNRSFSIQGSGNAAGFTDVNATAWFYSEVDKANYMA… |
| A0A7X8MJ82 | 20-474 | None |
| A0A0Q9L5X2 | 19-448 | None |
| A0A516KJB4 | 20-486 | None |
| A0A3G1KLV7 | 1-517 | None |
| U5CVU6 | 2-360 | None |
| A0A6P1MBL7 | 22-526 | None |
| A0A1W2C1L8 | 21-474 | None |
| A0A7X8U917 | 5-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.