DPCstruct | MC16229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 183 ± 23 aa |
| Standard deviation of domain lengths | 22.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF09484- PF09709 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2BB13 | 14-189 | DLLETYDTQKDTRCICPIAHTQIIANIGIMLDESSNILAAAKIRQSIFAPCTAKSECRSSNIAPHLIHDKVTYVSGINEKRHNAYME… |
| A0A359B306 | 1-189 | MILLALKEYYDRKAADPESDIAPEGFEKKELQFLVVIDAQGRFINIEDTREKMGNKLVAKTFLLPRSVGRSGSRGYETTFLLWDHIG… |
| A0A517M0I0 | 2-203 | None |
| U2CFN8 | 1-177 | None |
| A0A369TA45 | 1-195 | None |
| A0A221W3K7 | 2-172 | None |
| A0A848CGQ7 | 16-154 | None |
| A0A838QUV2 | 3-139 | None |
| A0A833LUB8 | 2-193 | None |
| A0A0Q5Q329 | 2-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.