DPCstruct | MC16228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6SWV3 | 3-72 | EFLAIGDLVVRKSYDQDVVFKVVSLNEGIALLRGICARVMADAPLSDLVKVNSDYAAMQEEHFEALRRKI |
| A0A358QYH1 | 2-96 | SDIKEGDVVARNSYNRDIYFKVVRLYTGEDGKLYACLKGLDMRLEANAPLDDLVMIEPPAVSMYCEKRQAECMEKIKYVIIRRDESL… |
| A0A1S9CLJ5 | 1-76 | None |
| W4VCI9 | 3-82 | None |
| A0A832QEH2 | 2-70 | None |
| T2RCP3 | 1-83 | None |
| R4K0S1 | 1-81 | None |
| R6H2H2 | 2-81 | None |
| C3AG39 | 3-78 | None |
| A0A5B9YIY0 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.