DPCstruct | MC16227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 299 ± 60 aa |
| Standard deviation of domain lengths | 59.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.84 |
| Pfam Score | 77.22 |
| Assigned Pfam label(s) | PF11760- PF11761- PF01890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662J283 | 3-313 | VLLWVPSADDESKAISSVLRSYGLEVKTVKGTISRARKYLYKSWNTLNFVIGIAPLPLCVRLISGLLKSKYEDPSVLCVTPDKNYVL… |
| A0A356UFK4 | 3-384 | IAVITLTRQGTKLGEELSCKLPAVATADLPVTFNNETQDNYQFHLFVPVKFACPSKSVFLNGPQIYPRTQRFSFACPLRELVAYLFP… |
| A0A6I7PZN9 | 16-268 | None |
| A0A412ZU32 | 5-319 | None |
| W7SN62 | 107-470 | None |
| A0A7W0ELE6 | 159-482 | None |
| A0A7R9N701 | 4-289 | None |
| A0A661PQM1 | 117-464 | None |
| A0A7V3LX96 | 2-238 | None |
| H0UMW2 | 3-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.