DPCstruct | MC16225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9W4U3 | 3-86 | SHRESDDSYRQVVVILNESWRIVECNMAVQWILQRAKNKRCGRAWASEGFCRSREALIRLSTGKSGQIEPSARTFLDTLPTRFE |
| A0A1M7C2P9 | 3-91 | IAQRNHHETSDSYAGVIARLCPRHRVIICRDGIQLITQRRKNGGAERPWRSLRYFRTREALMRFCATLCERVDPAAWAALATLPDII… |
| A0A3F2UBF3 | 3-82 | None |
| A0A7U4ZAI7 | 45-135 | None |
| A0A6A7KPX7 | 2-74 | None |
| A0A3B9EMF1 | 6-92 | None |
| A0A1M7TER5 | 32-158 | None |
| A0A5B8B4C9 | 1-79 | None |
| A0A3F2UGH0 | 31-123 | None |
| A0A7G6SQ25 | 103-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.