DPCstruct | MC16218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 157 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3H628 | 6-161 | EEIVMTPSKKGKATRIKIERKRRKELDPTQIAHEAGGQHKGLVVGKDIGEDKDDASPQLQLEFKCWLEDAKSGMHIPEGRLIKFWFV… |
| A0A0M9A2R9 | 3-160 | EHIVMTPKCKTANSTTLIIERQALEPPKENGNENNVHVAGGDHKGIVINKQAAAVTNGEIHPAHLCLQFRVFLVSAQSGKHTQESRT… |
| A0A812BR42 | 2-166 | None |
| A0A835G8U6 | 16-175 | None |
| A0A443STB9 | 6-160 | None |
| A0A1Y3EKZ1 | 4-167 | None |
| A0A821EH85 | 13-164 | None |
| A0A2P8YYH7 | 227-382 | None |
| V4BP35 | 5-155 | None |
| N1PB86 | 12-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.