DPCstruct | MC16213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835UE70 | 48-147 | NSVGHVADDLLKPSEMTKITVGPNDPTHEDISNFIIKFKSVFKCRLCPRILCLNETSVTTHLTSKRHARSRKLFSEGRLKLMLNSDG… |
| I1NNG2 | 103-218 | ILRHEEDPEINSSVKRASSGKADSTKDASDTDDALEVDFNNYILKCKSVYKCKLCPRIICLNEEMVRVHLKSKRHARSKKLLGEGRL… |
| A0A7N0TWJ0 | 1-138 | None |
| A0A2K1JH40 | 101-230 | None |
| A0A835PTY0 | 90-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.