DPCstruct | MC16211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 225 |
|---|---|
| Mean domain length (aa) | 67 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3B806 | 115-165 | VKKWYVVTVGQDVGIFSSWLDVAARIRGVPEPAHISRPTYAQAVAEYRQQF |
| A0A1D6HEC8 | 152-220 | QATPMAWYVVHVGRQTGVYSSWEACHAQVNGCKGACYKRYNSREEAMTAFNGHDNEDKQQEVPVLLRNK |
| A0A1U8DWY5 | 66-116 | None |
| A0A2H3EKX7 | 49-134 | None |
| A0A2P8ZK00 | 17-80 | None |
| A0A177VFQ2 | 178-231 | None |
| A0A177VGP9 | 6-67 | None |
| A0A0D2MDB6 | 2-59 | None |
| G4TH36 | 61-128 | None |
| A0A2I0HJD9 | 165-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.