DPCstruct | MC16209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 112 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0158- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6ZZ84 | 310-420 | FDDVFVMDRDVAGIPLDTRERPLQLLAEFHHPVSRINLQVHSTEPAFQFYTGQGTNVAAVDGNPSRGPFSGFCIEPSRFVNAINEPD… |
| A0A1D6HBB8 | 109-198 | GARFTLARVWDGATGRAMELWADQPGVQFYTSNGLAGVRGKGGSVYRRYAALCLETQGFPDAVNHPSFPSQIVRPGKVYSHDMLFKF… |
| R7QY57 | 66-151 | None |
| N1QSC5 | 137-226 | None |
| A0A3Q7F8V6 | 877-992 | None |
| L1PZU2 | 4-86 | None |
| A0A0X3NZ47 | 111-236 | None |
| A0A2A2QQ31 | 716-817 | None |
| A0A7X6VJ67 | 2-73 | None |
| A0A0R2JUZ4 | 21-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.