DPCstruct | MC16203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9F2M8 | 109-239 | KIMSKMGISTIASYRCSKLFEAVGLHRDLADLCFQGVVSRIGGASFSDFQQDLQNLSKRAWLKRKPLEQGGLLKFVHGGEYHAYNPD… |
| A0A6M1CSC7 | 3-129 | ISAVSSYRCAKLFEAVGLSDSVAELCFRGVPNRIGGADFSDFQQDLHNLSRLAWLPRKPLDAGGLLKYIHNSEYHAYNPDVIATLQK… |
| A0A376FFX0 | 55-185 | None |
| A0A6J1W9E8 | 66-200 | None |
| A0A809WN68 | 80-226 | None |
| A0A397EI07 | 365-460 | None |
| A0A2R7RNQ8 | 612-736 | None |
| A0A6G3V1M5 | 90-218 | None |
| A0A0Q9XCL6 | 801-951 | None |
| A0A1V3XAT0 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.