DPCstruct | MC16201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 169 ± 20 aa |
| Standard deviation of domain lengths | 20.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF21070- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485BQ87 | 2-148 | VANWHTAFDGRFPFAVSKSDASLPMLAEFIRKDSGRIDRFLTTELNGVLHKEGSQWVPDTAHSQGLTFNPAFLRAVNQLSQLSDILF… |
| A0A6M1CQJ4 | 8-151 | DQAWIVVKKEAIRYLEVEWNESVVKQYNCYIAGRYPFDPKSNRDVPLSEFERFFKPGGTLDAFWQLNLRPFAENNLLVNEDGQSLIR… |
| A0A017HSU6 | 79-266 | None |
| A0A2V9YZ66 | 102-263 | None |
| A0A447JMU7 | 6-147 | None |
| A0A1I3NGR2 | 634-811 | None |
| A0A501WIK9 | 607-767 | None |
| A0A520J748 | 40-192 | None |
| A0A3M5UBL3 | 2-151 | None |
| A0A411WJ79 | 8-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.