DPCstruct | MC1620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0KLT6 | 2-72 | DYHISLMRSARNQLLCIPISKQSPEYAAIFQSIQAYLRTNCAHHIIEDMVDIHPECSQTIYYCEYCEITFD |
| A0A6C0AV07 | 3-76 | AEQQYDIEVMLNAYNLLESLPDELRCVEYKKILKGIHNYIINNCKHEYITDMIDVDVERSETIVYCKKCYYTPN |
| A0A6C0D957 | 6-85 | None |
| A0A6C0JX25 | 12-89 | None |
| A0A6C0HPW0 | 10-86 | None |
| A0A6C0F0F0 | 2-68 | None |
| A0A6C0DSJ9 | 18-93 | None |
| A0A6C0INZ8 | 84-155 | None |
| A0A6C0DKM2 | 4-79 | None |
| A0A6C0IN52 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.