DPCstruct | MC16198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N0HSX5 | 135-263 | LSETQIAELQQKAEAIEKWAETLGLEVHFFLMDAEKFRSGEKSELSKESSGSAQHNLLLDEFYRTGLHIAGRIPIWWLVPPEHEHDY… |
| A0A6M1CMS0 | 1-131 | SWLDHDEKQNLRRKCTLIEEWAAAKGIDVTFFLIDENRFRHNASGSLNGEDCGSTQHILLLDEFYRTAVRMAGKRLLWTMVPAEEEH… |
| A0A6H2F1Y3 | 1-109 | None |
| A0A0B8PYN4 | 1-129 | None |
| A0A379X3H2 | 2-120 | None |
| A0A2X1REV4 | 23-154 | None |
| A0A448MTZ4 | 125-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.