DPCstruct | MC16197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 197 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4U7N0 | 644-816 | MEKFCEGRFWKEEELFDSAVNKPFVTDLYWCRGNICYGMNDTTDINLPPMNWTLNEISQIFGFNLDPLVKSNIAGWANRMNEIVERL… |
| A0A1Z5HML4 | 151-353 | FCDAVKSQLDESLKSNFYWCCNSKCYSPCQKDYNPFQWEKYTLRDFIKILSIPFDNDLYYRFVSVVNRVNRLLEKLKCNSCNKLMRD… |
| R6AR25 | 27-189 | None |
| A0A4R5CTS7 | 344-551 | None |
| A0A428V4Z3 | 730-913 | None |
| A0A5B3FZY5 | 235-448 | None |
| A0A0B8Q9L7 | 536-750 | None |
| A0A372DYK6 | 270-464 | None |
| A0A5E7UWX6 | 379-581 | None |
| A0A198XMB2 | 236-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.